our sponsor

Followers

Tuesday, September 27, 2011

…apabila budak hardcore menjual burger, you’ll get BURGERCORE!



Laporan asal : Facebook BURGERCORE

Twitter Worldwide Top Trending : #PerbualanGempak





goodnite twitter. Harap esok hari saya takde intention untuk membahan kamu semua. #PerbualanGempak

Saya terer buat drumroll masa intro Territorial Pissing. kalau nyanyi lagu tu, saya dah jadi org lain. #nevermindlive #PerbualanGempak

They shouldve mentioned "clerks", "mallrats" or maybe "chasing Amy" or "Kids" if they wantd to talk about MTV. sorry,Gen-X. #PerbualanGempak

"I hear Iran doesn't have one overrated band, you should go there." #PerbualanGempak

#PerbualanGempak Sapa-sapa yg kutuk Jason Newsted lepas tu nama glamer FB dia ada 'Ulrich', dia sama douchebag mcm Lars Ulrich

"Sapa yang pi Suicide Silence memang keturunan anak haram dan belen." #PerbualanGempak

"aku la gay yang cium Mitch Lucker masa gig Suicide Silence semalam. dia siap kata 'I will fucking kill you' lagi." #PerbualanGempak

more like "40 juta pecah punggung." RT @zamnayan "40 juta pecah panggung" #PerbualanGempak

"Hanis Zalikha, kau boleh 'unfriend' laki aku tak?" "Hanis ni sapa? Anak lord? Penjual kolagen?" #PerbualanGempak

"Lady Gaga follow twitter aku." "Aku tak peduli sangat tapi ko boleh follow Fred Durst, pahal?" #PerbualanGempak

"Aku baru je interview Parkway Drive ni." (interview email je, tu pun by third party. Tapi dgn Andrew William, that's real) #PerbualanGempak

"i don't get Lamb of God. aku punya menyirap riff habis semua dia tala Vision of Disorder." #PerbualanGempak

Band ayam je semua ni #PerbualanGempak

Sunday, September 25, 2011

Twitter Worldwide Top Trending : #headlinemangga Headline majalah MANGGA pula yang jadi popular!



Selepas Khairul Fahmi, Faliq Fahmie, Ziana Zain dan hashtag #SayaGenerasi, kini giliran #headlinemangga pula menjadi Trending Twitter Top tahap Gaban Z potong 8.

zamnayan Zam Nayan
#headlinemangga wu tang clan buat album nasyid

ili_fm ili_fm
RT @alamyk: #headlinemangga chino moreno kahwin lagi

nazriahmadeus Nazri Ahmadeus
Vokalis Naratu diburu VIP #headlinemangga

nasz113
korang ilekk je,esok aku ajak @farizalmuzakir lak! #headlinemangga

nazriahmadeus Nazri Ahmadeus
#headlinemangga Chris Garza jatuh cinta artis cun Malaysia!

nasz113
Filem "Cinta Tembikai Purple" mengutip 1.2 Billion Ringgit #headlinemangga

EsOasis Buskers
RT @asharahkamarul: RT @fadolsharifudin: Vokalis KORN terkena buatan orang. #headlinemangga

asharahkamarul asharahkamarul
RT @fadolsharifudin: Vokalis KORN terkena buatan orang. #headlinemangga

fadolsharifudin Mohd Zulfadli
Vokalis KORN terkena buatan orang. #headlinemangga

ili_fm ili_fm
@nasz113 #headlinemangga hahaahahahahhaahhahaahahhaahahahahahahahahahahahah

nasz113
haha! notbadddlaaa! RT @fadolsharifudin: @nasz113 bintangi karipap2 cinta 2. Kelas gitew! #headlinemangga

ili_fm ili_fm
Haaaaa apa ni? Ada #headlinemangga ke? Ahahahahahahahahahah

nasz113
AG Kismis sudah berpunya? #headlinemangga

fadolsharifudin Mohd Zulfadli
@nasz113 mcm baekk je #headlinemangga ni haha!!

asharahkamarul asharahkamarul
Pendedahan cinta, hazami dengan siapa? #headlinemangga

fyeda_abdillah *Fyeda Abdillah*
#headlinemangga "ye, mmg ada datuk lamar saya" *sambil berposing tepi kolam nampak cleavage*

BoyObsesi nazrin ariffin
#headlinemangga » hazamon tidur sewaktu sidang media

asharahkamarul asharahkamarul
RT @nasz113: "Editor Kosmos Sering Mandi Berdua" #headlinemangga

nasz113
"Atlit Bina Badan Negara diserang Ahmar Wind" #headlinemangga

mybangsar What's up Bangsar?
RT @nasz113 Penyanyi Kumpulan Nasyid TAQWA bukak kedai "Tatoo" di Bangsar #headlinemangga

HafizxNazri hafiz nazri
RT @nohsalleh: "Mitch susah tidur gara-gara dicium waktu persembahan oleh peminat Malaysia" #headlinemangga

Pendi77 Fendi Ahmad
@Big_Is_Evil yg ciom eh?hehehe RT @nohsalleh: "Mitch susah tidur gara-gara dicium waktu persembahan oleh peminat Malaysia" #headlinemangga

nasz113
"Editor Kosmos Sering Mandi Berdua" #headlinemangga

nohsalleh (Noh Hujan)
"Mitch susah tidur gara-gara dicium waktu persembahan oleh peminat Malaysia" #headlinemangga

hairi_lee hairi
saya bukan perampas - Neelofa- #headlinemangga

nasz113
Penyanyi Kumpulan Nasyid TAQWA bukak kedai "Tatoo" di Bangsar #headlinemangga

izzatuzaini
"Siti Sarabanun gerun jejaka maskulin" #headlinemangga

RoboardDM113 Firdaus Nazri/robot
Hahahaha! RT @nohsalleh: "JIJI terkejut Disapa artis K-POP kegemaran" #headlinemangga @izzatuzaini JIJI tu kira ... tmi.me/grHUV

BoyObsesi nazrin ariffin
#headlinemangga « ways kebali bersatu setelah baskin bersama di pasar seni

TigerSopey Saufi Zakaria
Drummer bawah umur dicekup dikelab malam #headlinemangga @nasz113

najahmohdl Cinderella Urban
Joget manjoy ? RT @izzatuzaini: "Gambit Badrullah nafi joget manjoy berseorangan" #headlinemangga

nohsalleh (Noh Hujan)
"JIJI terkejut Disapa artis K-POP kegemaran" #headlinemangga @izzatuzaini JIJI tu kira nama salah satu ahli MAX247 laa *tiba2

azzin_aziz Azzin Aziz
RT @chacharitto: Ahahha..mcm pukimak laa..haha RT @nasz113: "vokalis kumpulan Straight Edge Manjung, positif Shabu" #headlinemangga

azzin_aziz Azzin Aziz
RT @nohsalleh: RT @asharahkamarul: RT @izzatuzaini: "Gambit Badrullah nafi joget manjoy berseorangan" #headlinemangga

TigerSopey Saufi Zakaria
Haha, mcm best je #headlinemangga kau ni @nasz113

BoyObsesi nazrin ariffin
Haha!! Lawak Sial!!RT @izzatuzaini: "Gambit Badrullah nafi joget manjoy berseorangan" #headlinemangga

asharahkamarul asharahkamarul
RT @izzatuzaini: "Gambit Badrullah nafi joget manjoy berseorangan" #headlinemangga

nasz113
"Duta Bank Negara Nafi Pinjam Along" #headlinemangga

asharahkamarul asharahkamarul
RT @nasz113: "vokalis kumpulan Straight Edge Manjung, positif Shabu" #headlinemangga

izzatuzaini
"Gambit Badrullah nafi joget manjoy berseorangan" #headlinemangga

asharahkamarul asharahkamarul
Artis meriahkan rumah terbuka kak nor. @izzatuzaini @adibhassan @nasz113 #headlinemangga

chacharitto shahrizam abd malek
Ahahha..mcm pukimak laa..haha RT @nasz113: "vokalis kumpulan Straight Edge Manjung, positif Shabu" #headlinemangga

izzatuzaini
"Sham Jaszle nafi dengan Datin A" #headlinemangga

nasz113
"vokalis kumpulan Straight Edge Manjung, positif Shabu" #headlinemangga

izzatuzaini
RT @izzatuzaini: @adibhassan @nasz113 "zamzuri tak segan jual pisang goreng di bangkok bank" #headlinemangga

nasz113
@izzatuzaini @adibhassan hahaha jom main weih #headlinemangga nie

izzatuzaini
@nasz113 @adibhassan "dinzly baru berfacebook" #headlinemangga

nasz113
"Uztaz Razali Nafi Dedah Aurat di Bukit Bintang" #headlinemangga

nasz113
"Dato Shuhaikim sering ke Bilik Air" #headlinemangga

Saturday, September 24, 2011

Twitter Worldwide Top Trending : #sayaGenerasi



Macam boleh tahu je sapa yang start... some celebrity pun jump into bandwagon of tweets yang biasa-biasa je....

Hannah Yeoh #sayaGenerasi Kimisawa and Thrifty
faizal ismail HotFM #sayaGenerasi rekod lagu favorite kat radio guna cassete player, tekan play + rec serentak. Kadang2 geram sebb missed music intro
Diana Danielle #sayaGenerasi WWF! The rock, stone cold, the undertaker, china. LOL.
Hannah Yeoh #sayaGenerasi Four Heavenly Kings
YASMIN YUSUFF Big ups to the guy who started the #sayaGenerasi trending topic-the feelgood tweets of remembering the 'good old days' are incredible!
Lim Meng Keong Wow! #sayaGenerasi is trending no 3 worldwide...
Joe Lee #sayaGenerasi satay Haji Samuri Kajang yang original yang murah dan yummy! Skang yucky.
Fahrin Ahmad #sayaGenerasi "Pen merah pen biru, you marah I love u.."
KL Traffic Update RT @LydiaAriffin Xde #sayaGenerasi generasi hai! Gimmer updated info from federal to sg besi pls! kltu tq in advnce
YASMIN YUSUFF Kihkihkih!Nothing's been the same since!RT @ImanAnnieShaw: @tomsaufi #sayaGenerasi disco kat hilton tinMine
Sharifah Amani Yahya #sayaGenerasi - Captain Planet, Quantum Leap, A.L.O.N.G, 4U2C, KRU, NKOTB, BSB, Spice Girls, Back Room, Nouvo, Stussy, Baby G ;)
Aznil nawawi HM #sayaGenerasi Fantasy Island "the plane the plane!" Kan @chedd
Najua boltz #sayaGenerasi SWAG.
Farid Kamil Zahari #sayaGenerasi Eric Cantona 7 ManU...berbaju sekolah Cantona7 kot rasa dasyat betui abaq hang..!
Aishah Sinclair #sayaGenerasi hari Sabtu bangun pukul 8pg tengok My Little Pony followed by Robotech.
Aishah Sinclair #sayaGenerasi Mira Edora, Abang 92. Azhar Sulaiman no.1 heart throb!
aznil nawawi HM Zaman Paknil gak! RT @kitana64: @aznilnawawiHM #sayaGenerasi drama bersiri michael london-little house on the ferry
Muhammad Akbar ▲ #sayaGenerasi yang kurang tengok tv kerana banyak menghabiskan masa bersama internet.
Hansen #sayaGenerasi ice cream potong for 20 sen n watching Teenage Mutant Ninja Turtles!
Sashi C Loco Word. RT @___december: #sayaGenerasi Poetic Ammo @cloco @pointipohmali
eddydaud Ah, those were the good old days RT @khairulryezal: #sayaGenerasi berkenalan guna surat, ada dapat surat wangi… (cont) deck.ly/~xTRAL
Fendy Zachariey™ #sayaGenerasi N'SYNC, Backstreet Boys, Boyzone, Weslife etc, bukan @JustinBieber or @CodySimpson #justsaying
TheAqasha Aqasha Leé #sayaGenerasi dating di library masa sekolah menengah sbb duit xde, just tambang bas. Look at me now! Siapa x date aku dulu rugi! *emoplak*
Lisa Surihani #sayaGenerasi 'transformers! More than meets the eyeee'
Rev. Eddy Lim #sayaGenerasi iklan don't drink and drive "ed... ed... i killed my brother..."
IniAnwarHadi // Anwar Hadi #sayaGenerasi whose line is it anyway, the show where everything is made up and the points don't matter..
art_tech najib #sayaGenerasi gig kt Factory BB!
LizaIskandar™ #sayaGenerasi tangkap gbr guna kodak. Kodak habis meraban cari kedai jual kodak. Pahtu htr kedai cuci gbr. Tunggu 1 hari br siap. Haaha
Dabush Kamarudin™ #sayaGenerasi pukek britney spears belom buey
Syahredzan Johan Classic! RT @yedwin01: @syahredzan #sayaGenerasi street fighter original, dan Samurai Showdown ;)
Ho dal ya jim ha #sayaGenerasi "bulat kecik bulat kecik bulatlah besar. Sayang mama sayang papa sayang semua. 6kali 6kali, 36.. 6kali 6kali sayang semua."
Lisa Surihani #sayaGenerasi 'don't go chasin' waterfalls...' TLC baby. Lisa Lopez I miss her.
nurul izza #sayaGenerasi makan sagu sampai tersembur2 zaman sekolah rendah agama!
Altimet #sayaGenerasi beli Tone magazine tiap2 bulan.
Cassandra Jane #sayaGenerasi rewind kaset to hear my favourite song.

SoMalaysian pun nak #sayaGenerasi jugak dengan dia punya 'ding dang dan tora datang lagi'..... so Malaysian....


tapi yang paling best came from Obefiend with his tweet : Baguslah hashtag #sayaGenerasi dah habis....... aku lagi sikit nak tumbuk monitor pasal annoying babi gak hash ini selepas jam ke 5

mesej ini untuk syukritahir dot com regarding video Adinda Evans


"Apa motif video ni dibuat aku pun tidak pasti,adakah kerana ingin terus memanjangkan lagi kisah Adinda Evans?"


Motif? Oh, yes, motivasi saya ialah I believe I can fly. I learn that from Maria Elena, the hard way.

Ironi lah kan, sebab entry blog anda pun lagilah 'memanjangkan lagi kisah Adinda Evans'. Saya tak tulis seinci benda buruk pun pasal budak tu tapi anda gebang habis satu dunia pasal budak Adinda Evans tu sekian-sekian. Shame on you.

Ok lah, motif video tu ialah untuk memperkenalkan salah sebuah album post rock terbarik bagi tahun 2011 iaitu This Will Destroy You - "Tunnel Blanket" yang menunjukkan dynamic shift bagi mereka yang mana muzik mereka bukan lagi klon Explosions in the Sky tetapi lebih kepada membentuk bunyian tersendiri dipanggil 'doomgaze', minus grimgrobe ala Sunn O))). Cuba sebut Sunn O))) betul-betul. Dah tengok video tu? Good.... Dah dengar lagunya? Bet you don't give a damn at all.



Go back to your AF chair. Jana lah trafik sepuasnya. Get stupid. Me too, don't give a damn at all.

Puteri ShaSha Mendoza versi translasi yang sungguh berjurus



Ohyeahmarikitamenaikkantrafiktahapgalvanize!!!

Hello, di sana. Adakah Shashi. Puteri Shashi. Saya tidak tahu apa dan bagaimana untuk memulakan, kerana semua orang tahu buruk di. Saya menghuraikan sebagai seorang yang peramah. Benci elegan, kerana saya berfikir orang yang berada di sekeliling anda, saya membenci anda. Secara jujur​​, saya orang yang besar jika anda boleh beritahu saya, tetapi kadang-kadang saya mudah kecewa dan marah. Saya perempuan dan saya cuba untuk mengimbangkan sejuk dan saya bekerja, jadi jangan risau. Morder.Estou Saya bukan fesyen bergantung. New York jalan fesyen. Adakah ia baik? Dengan baik, ia adalah untuk saya. Saya suka kasut atau tumit orang-orang yang tinggi memanggilnya? Ah, ya! Saya fikir ia sangat guaman bagi tumit perempuan, kerana ia menunjukkan betapa seksi mereka. Jadi, gadis gadis :) Saya suka membuat kawan-kawan baru. Saya benci kawan kaya kaya kaya dan baik! Jadi, benci, bukan sahaja dapat menyingkirkan segala sesuatu? Usahlah menilai seseorang yang tidak mengetahui. Saya tahu anda tidak mempunyai hidup. Jadi, saya menyeru membosankan bukan? Ah, tetapi saya membenci dia, kata beliau tidak akan membawa saya. Saya tahu saya hanya boleh menilai seseorang dan klik Anon Blog kemasukan yang sangat baik. Saya benci hanya benci. Percayalah, saya tidak fikir orang benar-benar embaraçoso.Principalmente tidak akan melawan, saya bukan seorang perokok, saya cuba shisha dan hanya perkara yang penting ialah dara saya. Jadi, beri saya tepukan yang hebat. Aku katakan, I love you. Virgo adalah unicorn. Berdosa untuk melakukan hubungan seks sebelum perkahwinan. Hanya mahu berkata, kecuali keperawanan untuk suami anda dan rakan anda tidak kerana kita tidak tahu apa yang akan berlaku tidak lama lagi dalam masa terdekat. Itu simpan lebih baik. Saya tidak cuba untuk menjadi bodoh di sini, tetapi ia hanya motherboard mim.Eu tinggal dengan keluarga yang sangat besar. Saya suka keluarga saya lebih daripada segala-galanya. Dan satu perkara lagi, saya tidak percaya dalam cinta pertama. Beliau lieeee. suka hartanah. Terima kasih kerana membaca Tumblr saya. Saya ingin anda semua satu hari yang baik.Menjadi Fellasss.Loads berhati-hati Cinta: shashamendoza XOXO

p/s: apa? gambar bogel shasha? sorry not here, i wanna bust your buddy.


Thursday, September 22, 2011

RE : Melodi @ Tv3 - Layan... Zass...



nie adalah petikan komen salah seorang penonton MELODI...


Saya adalah peminat setia rancangan Melodi sejak mula-mula ia diperkenalkan oleh TV3 dengan pengantaranya saudara Mahadir Lokman. Ketika itu konsepnya ala-ala rancangan Entertainment This Week dan formatnya lebih kepada melapor acara-acara atau aktiviti dunia hiburan tempatan dengan gaya formal dan ada kelas, bukan ala-ala pojok murahan seperti yang sekarang ini.
Gaya penyampaian Mahadir ketika itu pun formal dan gentleman dengan pakaian blazer dan tali leher/bow tie mengikut kesesuaian. Zaman berlalu, Melodi melalui pelbagai transformasi dan perubahan dari segi persembahan dan pengacara, dari Fauziah Ahmad Daud, Saiful Apek sehinggalah Wahid Senario dan Fara Fauzana sekarang ini.
Malangnya, dari pandangan mata kasar dan pemikiran cetek saya yang kurang mengerti tentang dunia hiburan ini, saya melihat rancangan ini semakin lama semakin rendah kualitinya. Melodi banyak merapu, biadab, bongkak dan bodoh sombong semata-mata kononnya atas alasan telus, berani kerana benar dan macam-macam prinsip tong kosong.
Sebaliknya apa yang dikejar, digilai dan disogokkan oleh Melodi ialah banyak ‘cerita yang direka-reka’ (bila direka maksud saya dilebihkan liputan tentangnya dan disensasikan hingga ke titisan lensa, pena dan peluh yang terakhir) berbanding berita. Misalnya, kisah perkahwinan dan cerai-berai artis, artis itu bergaduh dengan artis ini, artis itu skandal dengan datuk sana dan datin sini, Apa ini? Meluatlah.
Yang saya nampak, apabila suatu filem atau album baru diedarkan atau ditayangkan, wartawan Melodi lebih cenderung bertanyakan soalan pesimistik tentang berapa kutipan atau jualan yang boleh dicapai dalam keadaan ekonomi sekarang, atau jika dibandingkan dengan filem yang sepatutnya berjaya tapi gagal di pasaran, (katalah apa pun, tapi tone suara yang negatif itu, boleh dihidu oleh penonton biasa seperti saya).
Saya juga kesal dengan penampilan berlebihan wartawan Melodi seperti Michelle, Nas Ahmad ‘Abang Rambut Ketak’ dan lain-lain.
Melodi perlu jujur dengan slogannya sendiri ‘tingkatkan prestasi bukannya sensasi’ sebelum ia boleh mengemudi artis dan industri hiburan tanah air ke arah tersebut. Bukan hanya pandai cakap saja.


so... ape komen korang lak pasal MELODI nie x kisah la pasal pengacara wahid & farah ke, pasal isi cerita dlm melodi ke, pasal terjah abg nas ke, ape2 aje la komen, pujian, kritikan, puas ati ke x puas ati thadap rancangan MELODI @ TV3... . layan zass





melodi tayang apa yang orang nak. #fact

katalah macam mana pun pasal program tu, sifat curiousity anda pasti akan menarik anda untuk ikut bergosip setiap ahad 12:30 tengahari.

i was thinking kalau satu hari melodi akan buat macam zaman mahadzir lokman dulu, mahu penonton melopong seraya berkata, "what the... " dan sentiasa bertukar siaran.

originally from Virtualfriends

Why Upload Pic Mendedahkan Aurat???


Q : Aku x tau ler dah ada belum thread ni... kalu dah ade soriler... aku nak tanye pd setengah2 pompuan member2 VF ni.. aku bukak Vf ni kan selalu tgk member2 kite pompuan lah kan.. mereka upload pic..mcm2 la..tp yg aku hairanla kan... setengah dr pompuan nih upload pic yg memdedahkan aurat..yg baju lengan pendek la dedah lengan..yg free hair laaa kan..n yg paling ku heran..dlm profile ada pic yg bertudung n sopan dan ade jugak sekali upload pic yg dalam bilik yg berbaju lgn pendek n free hair... korang x rasa berdosa ke x rasa membuka aib sendiri n jatuhkan maruah sendiri ke cube bg tau sikit ape kebagusannya buat cam tu bg setengah2 pompuan nih... aku heran laaa..


myb diorg rasa diorg lawa kot klu free hair..
certain2 laki kan suka dgn dak2 free hair ni


ko pun upload pic dedahkan aurat.. ko rasa diri ko lawa ke..
ko tahu ke apa aurat wanita.. cuba ko bagitau aku kat sini..


weyh pacik..aku ckp "free hair" la.. aku rasa aku gna ayat bahasa melayu yg simple kot,...


aku tahu la ko cakap pasal free hair... free hair tu = aurat kan.. sebab kita cakap pasal aurat.. bila aurat.. aku tanya ko la pulak.. lengan ko tu.. bukan sebahagian daripada aurat ko ke


lengan mn la plak ko ni zat.. haish...


tu gambar profile ko tu...
nampak lengan kan...
check betul2... .. auratttt...

... ... ... ... ... ... ... ... ... ..


adoyaiii zat.. e2 mmg kesilapan aku la kan.. huhhu
tp aku cma nk highlight org yg free hair..yg x pakai tudung.. ada phm x..


buat apa ko nak highlightkan kesalahan org.. sedangkan diri ko sendiri buat salah..

... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ... ..


klu d ikutkan masing2 pun penah wat kesalahan... . bajet ko 2 malaikat la x penah wat silap..
aku rasa aku komen kat thread ni juz bg pndangan, bkn nk kutuk o tgur sape2... . n terima kasih atas teguran ko 2.. aku sgt hargainya...



pwned!!!

Penjual Burger Tak De Masa Depan ?


Q : haha, ni nak cerita la. ada ke patut seorang perempuan kat radio kata penjual burger tak de masa depan untuk kawin duit tak banyak lepas tu tunang minak cerai lak
apa punyer perempuan ni Ego/hidung tinggi tak mancung pulak tu
masalah dier didengar oleh saya rasa berjuta orang kot.
nanti saya cuba dapat kan clip perbualan itu dari rakan facebook saya
kalau dapat mari saya berkongsi bersama yea...

so apa pendapat anda tentang perkara ini

anyway siapa yg makan sos cili 2 hingga 3 botol terasa kepanasan nya... ...


aku skang ni kalau nak makan burger, aku buat sendiri.

because it's a fact that memang peniaga burger buat duit skang. don't deny it.

kalau saya meniaga burger dengan serius (baca : pelan + strategi perniagaan yang bijak, eksperimen dalam resepi burger), tak mustahil i can make good living out of it.

semalam kawan saya post org meniaga burger + megi.

daging burger tu kapit dengan megi. effing genius!

perempuan yang cakap pasal penjual burger takde masa depan tu hidup zaman rafeah buang kot. Ramly Burger made it big.

so what's the fuss?

saya ingat lagi kat shah alam, masa tu nak pegi keje, ada post ad kat dinding 'mencari perkerja, menjual burger'. siap boleh menggaji orang lagi.

you see tengok konteks penjual burger sama ada pekerja yang menjual burger atau peniaga burger. those 2 are different.

tahukah anda, Ahmad Ronald McDonald Ismail sebelum membuka cawangan McD di seluruh dunia juga pernah menjual burger di tepi jalan. dengan menggunakan imej badut berstokin belang merah putih, dia berjaya hingga dapat membuka taman permainan untuk anak anda di kala menunggu hidangan disediakan. #truestory #troll

originally from Virtualfriends

hai, saya Izara Aishah !! Ini belog saya!!!



satu petang, sekeping hati, secangkir kopi, sebaris dialog....
Latif Borgiba : Ouh... sebatang lagi kayu yang cantik,...Izara Aishah namanya.
Remy Ishak : Kayu? Sampainya hati pakcik.
Latif Borgiba : Sebab dia berlakon macam kayu. Eh, don't we?
Remy Ishak : But not you!


sumber foto : OHBULAN

Wednesday, September 21, 2011

(UPDATED) ROCK THE WORLD 2011 : lokasi dan tarikh telah diumumkan!!



!!! UPADTE TERKINI : TARIKH TELAH DIUBAH KE 10 DISEMBER 2011 / LOKASI TETAP DI STADIUM MERDEKA !!!


Acara tahunan Rock The World telah mengumumkan tarikh dan lokasi bagi edisi ke 2011 nya seperti laporan Facebook mereka dibawah:

Hello Party People! Rock The World Adrenaline is now officially will be held on the 10TH of December 2011 at Stadium Merdeka. Stay tuned for our band announcement. Keep rocking rockafella!



18 nama telah diumumkan sebagai mereka yang bakal membuat persembahan:

Rock The World : Adrenaline
Attention boys and girls , this is our official announcement for the confirmed band to perform at Rock The World Adrenaline :

1) SALAM MUSIK
2) DAARCHLEA
3) MADDAME
4) AKTA ANGKASA (Watch out for their official website at http://www.senipekik.com/
5) KYOTO PROTOCOL (Watch out for their official website at http://www.kyotoprotocolband.com/ )
6) THE AZENDERS (Watch out for their official website at http://www.facebook.com/theazenders )
7) MASSACRE CONSPIRACY
8) PESAWAT
9) I REVIVAL
10) BITTERSWEET
11) RESTRAINT
12) BALLAD FOR LAYLA
13) STATIK
14) MONOLOQUE FT. ATILIA
15) MELODISASTER
16) REZA SALLEH
17) TEMJIN
18) THE PADANGS


More band announcement will be out soon. Do stay tuned with us. #RTWORLD





apa-apapun , sentiasalah mengikuti ruang ini atau Twitter Rock The World untuk pengumumman lanjut dan senarai penuh band yang bakal membuat persembahan.


Follow us on twitter @R0CKTHEW0RLD and our official hashtag is #RTWORLD to get more updates on upcoming band announcement and how you can participate in this years Rock The World Adrenaline!


sedikit info Rock The World yang telah berusia 10 tahun:

10 years running and still going strong, Rock The World is a major household name to music fans of Malaysia's rock scene.

Born in 2000, Rock The World has grown to be Malaysian's Biggest and longest running rock music festival. Every year Rock The World showcases the best bands and highlights new and upcoming bands coming through the ranks.


Laman rasmi RTW http://www.rocktheworld.com.my/

Here's the layout for the concert...


And bands schedule:









Mythbuster versi Malaysia : pelawat Beautifulnara ramai gay rupanya...


saya mula-mula ingat ianya mitos sahaja, tapi selepas hanya meninggalkan 2 cents yang mudah, dengan tidak teragak2 ramai yang menekan thumb down dengan gagah sekali sekaligus menyetujui kepercayaan popular yang ramai pelawat Beautifulnara adalah di kalangan gay. terutama sekali anda gula_melaka. serius, orang tak eja 'vangang'. itu macam kau punya keyboard rosak retak sejuta.

Tuesday, September 20, 2011

Ini ada sedikit pesanan 1Malaysia dari band deathcore, Suicide Silence



Disebut dalam akhbar Harian Metro sebagai follow up kepada kesesatan selepas tak ada idea lagi yang dapat dikupas selepas Black Metal hampir sedekad lalu, dituduh masonic la, makan darah la,kelar jari la,.... tapi aku tengok video ni rilek je. Wartawan Harian Metro ni betul ke tak betul ni main tuduh band?!

Anyways, .... ini band yang perlu ditonton secara live, bak kata majalah Revolver : "explosive and relentless". Maka tak hairan kenapa mereka ditabalkan anugerah Metal Gods oleh Revolver.

That said, pergi mati dengan segala tuduhan, fuck everything, let's go fucking nuts!

The Band Shop proudly presents… Suicide Silence Live in Kuala Lumpur!

—————————————————————————————————————————

Tickets available now at the following places/agents:
- Dolls Store (Bukit Bintang)
http://www.facebook.com/dollsstore
- Acoustic Music Pertama (Pertama Complex)
http://www.facebook.com/profile.php?id=100001643714732
- The Band Shop (Taman Melawati)
http://www.facebook.com/thebandshopstudio
- Joorue Shop (Kajang)
http://www.facebook.com/joorueofficial
- All Rock Corner Outlets
http://www.facebook.com/rockcornermusic?sk=app_106171216118819

THE CURVE
MID VALLEY
THE GARDEN
ONE UTAMA
KLCC
AMPANG POINT
SUBANG PARADE
BANGSAR

PRE-SALE : RM 92 (until 21st September only)
ON DOOR: RM 120

—————————————————————————————————————————

Online Ticketing Purchase is also available, just click on the link below & follow the instructions in the booking form. (Terms & Conditions apply)

http://eepurl.com/fs0us

—————————————————————————————————————————

Opening acts:

- Daarchlea
- Massacre Conspiracy

Time: 6:00 PM onwards
Venue: MCPA Hall, Jalan Maharajalela, Kuala Lumpur

YOU ONLY LIVE ONCE SO GO FUCKIN’ NUTS!

more info please visit - http://www.facebook.com/suicidesilence?sk=app_123966167614127





Kosmo Emo takkan dapat mengatasi Harian Metro Black Metal, guys...


...because emo is dead already. try it on deathcore. but first, macam mana rupa deathcore tu? dia ikat selendang kat lutut ke?

here's our conversation:

paper Kosmo hari ni baru nak tulis pasal budak emo kelar tangan. Mereka terlewat 10 tahun. Dah banyak tangan yang dah terkelar. Gahgahgah.


p/s: My Chemical Romance dah tak emo dah, diorang kini dah jadi warna warni The Cure dan Alam Ria Cuti Sekolah dan Pee Wee Big Adventure


Amin Muhammad true hahahahaha!

Yours truly Amin Muhammad : nak tulis budak metal tak boleh. budak metal defensif gila, ultra protection.

Amin Muhammad budak metal selalu jawab "alah ingat kami je ke teruk?cuba tengok budak clubbing tu!" and the cycle repeats.lol.

Yours truly Amin Muhammad : diorang jawab camni "abis budak AF telan pil sampai nak mati tu takpe?" hahaha

Amin Muhammad oh shit marsha hahahaha!

Kadir Chan HAHAHAHHA! damn straight !

Ahmad Tongkeng Takde bahan la dude. Serious. Benda basi.

Yours truly nak jumpa budak gothic pasar malam pun dah susah skang. so i dont know who are they targeting.

Afiq Ishaq really ke marsha 2 telan pil??? pergh info baru nie..
but mmg dr dulu kot...masa punk ngan skin kluar edisi siasat sume chop punk ngan sekutu ngannye 2 jahat..

Yours truly Afiq Ishaq : in this media twisted world, you dont know what is real. even scene budak macam rempit yang maki makcik yg keje org gaji dalam drama tv3 ni pun is unreal to me.

Cassim Smith Depa ni saja je nak sensasikan citer supaya paper depa laku, kemdian suh kita pikirkan yg bukan2. Aku layan the mission je...he he.

Fhive Aldino Helmi hahaha..diorg lmbt laa..

Kadir Chan we talked about tabloids after the show last sunday remember? haha

Afiq Ishaq true that....

Yours truly Kadir Chan : aku jumpa pontianak ahad malam lepas. dia tonggang JD atas stage lagi. oh shit serius. hahaha

Ahmad Tongkeng Tak psl2 jd isu Marsha telan pil plak haha

Yours truly Ahmad Tongkeng , Marsha back up kuat. haha

Kadir Chan hahahha!

Yours truly it's funny because emo is dead already. but, there was this one sunny day when wartawan Kosmo ni sudah bukak Tumblr....... and why Tumblr now? sebab founder Tumblr sudah jejak White House. Mark Zuckerberg pun tak jejak White House lagi.

Ahmad Tongkeng Hehe kalo marsha, aku pun back up hihihi

Yours truly Kadir Chan aku risau ni, in the next 5 years they're targeting at budak post rock pulak ni.

Kadir Chan hahahha..hopefully reggae won't be effected..

Nataza Mohd berita perdana mmg selalu begitu

Yours truly Kadir Chan , aku kan kuat layan Red Sparowes. tu tahap nota berdarah bakar orang tu.

Farhan Zul yg x tahan tu jimmy eat world pn kna,huhu...mmg x buat study lsg dema ni.....

Yours truly Farhan Zul the lowest point is how they relate 'mengingati si mati' dengan bunuh diri. the journalist dah sampai dead end dan deadline pun dah nak dekat.

jawapan saya pada "Zee Avi tak dicalonkan dalam AIM ke 18"


Zee Avi tidak layak dicalonkan kerana albumnya menjalani rakaman di luar Malaysia. Persoalannya, seorang bintang Glee boleh hargai bakat anak seni ini. Kenapa Recording Industry Association of Malaysia (RIM) menganaktirikan bakat Malaysia yang sedia ada?


- petikan dari OHBULAN!

ini soal nilai album. anda mahukan hasil yang terbaik untuk album anda. pengiktirafan macam dari AIM jatuh pada tempat kedua. katalah saya tak dapat hasil mastering terbaik di Malaysia dan ada bajet nak bayar Howie Weinberg kat US, i'll do that. bila hasil yang anda keluarkan pada sebuah album itu baik, bukan orang kat tempat kita je yg recognize, tapi orang luar juga. ini lebih bertitik tolak pada soal professionalism dan diakui memang kita jauh terkebelakang berbanding negara luar.

tapi yang lebih penting ialah muzik itu sendiri. katalah anda belanja production yang besar sekalipun sampai kat studio NRG Recordings atau Abbey Road, tapi kalau lagu yang anda hasilkan itu rendah nilainya, tiada siapa yang peduli.

mungkin orang2 di RIM mahu lebih ketat dalam soal produksi album dengan mengiktiraf studio2 dalam negara dan tenaga jurutera bunyi dalam negara, tapi saya rasa mereka boleh longgarkan sedikit dalam soal pengkarya iaitu penyanyi, pemuzik dan penulis lagu di dalam album tersebut yang sememangnya anak tempatan.

Friday, September 16, 2011

one more from Battles if you never had enough....



reaksi saya apabila melihat akhbar nasional memperkatakan tentang pengumuman mansuh ISA oleh Najib Razak



...tapi MANSUH ISA tetap remain serius. yang kelakar hanya perubahan tona akhbar yang mulanya macam menegakkan ISA kepada memperakuinya.

yang menyokong kerajaan, you've been punk'd by Najib. he's master at #troll more than anything.




this is post - #NajibsAnnouncement that has been circulating on Twitter one to one against #FaliqFahmie who sees the result of these tweets:
- semalam, semua orang berharap merekalah yang mansuhkan ISA instead of Najib, i know. not Martin Luther King enough eh?
- #najibsannouncement butthurt detected ---> papagomo / Papa Gomo
- #NajibsAnnouncement today ISa for najib, but it's still Mat Sabu for Utusan tomorrow
- #NajibsAnnouncement dah pesan kat Radiohead. harap mereka dapat mesej PM.
- #NajibsAnnouncement "you stole my idea!" - PKR , "no, i just make it better." najib zuckerberg
- #NajibsAnnouncement banyak idea untuk internet meme dan entry tumblr dengan gambar random teks random
- kamu semua dah banyak dosa kat Najib. di hari baik bulan baik, pergi lah rumah terbuka dia nanti. dan saya maafkan Najib kerana peraduan twitter menang alas cawan yg dia buat tempoh hari. #ikhlas
- kalau pegi Putrajaya, besar dia punya bunting kat bangunan 'hapuskan rasuah'. you know shit happens.
- #NajibsAnnouncement ISA mansuh. now, can we go on with 6% prepaid taxes?
- #NajibsAnnouncement the abolishment of ISA? does it mean that Radiohead now can play here? tell it to Thom Yorke


and finally from a friend Khairulnizam Bakeri™ @nizambakeri who goes by this :
#NajibsAnnouncement "Dear @anwaribrahim, it's Sept 16 once again. And I'm still here. Deal with it, loser."

Thursday, September 15, 2011

#FaliqFahmie Siapa dia? Well, he invented Twitter, guys... see him in David Fincher's Social Network part 2.



Haha, shame on you Twitter people!

Joke aside, saya pun tak kenal @faliqfahmie secara peribadi tetapi dia agak rapat di kalangan rakan-rakan mutual jadi Tweet randomnya akan selalu kelihatan di timeline yang kerapkali di RT. Dan, dia takde kena mengena dengan penjaga gol kebangsaan Harimau Malaya, Khairul Fahmi. #iknowilameliddat

Anyways, here's a Youtube video yang merupakan penyertaan rakan-rakan di Twitter untuk sebuah promo Perodua Kancil dengan ideanya oleh the man himslef, Faliq Fahmie.

Monday, September 12, 2011

Nuffanng earning : almost there


sebenarnya lama gak peram. tapi looking back again, lambat jugak start and i don't know why saya bukan opportunist tahap dewa. amat pesimis. this should be change.


anyway, selain Nuffnang, satu lagi affiliate yang saya pakai ialah Churp Churp. yang tu bapak laju. and that one pun almost there to cash out. yes, miskin. if in the 90's, i probably jual tin aluminum dan suratkhabar untuk menjana pendapatan.

dengan duit Nuffnang ini saya akan gunakan untuk bayar cukai 6% topup handphone.

demnit.



anyway, here's the hottest search on this blog for this week. patut tukar je nama blog ni jadi blog juliana evans.

p/s: saya tiada tips Nuffnang.

saya rasa saya telah ditumbuk oleh phoenix


saya dapat ilham ini semasa menulis artikel tumbok rusok yang terbaru. pasal sensasi. saya rasa memang ada banyak benda yang tak kena dan kenapa kita jauh lagi hendak menjadi bangsa yang progresif hatta prog metal dan mathcore sekalipun.

what is wrong?

this is so wrong.

we'll see in a few days. :)

Saturday, September 10, 2011

The Used : tarikan utama Rockaway


selepas penarikan 2 band asal, Sum41 dan Dashboard Confessional, The Used akhirnya menjadi nama terakhir yang bakal menghangatkan festival Rockaway ini. Laman web Rockaway juga turut dikemaskini untuk makluman pengunjung-pengunjungnya selepas perubahan saat-saat akhir ini.






Nurul Atikah Bazilah, remaja penghidap barah tulang kronik meninggal dunia


KUALA LUMPUR 10 Sept. - Remaja yang menghidap barah tulang kronik, Nurul Atikah Bazilah Samsudin, 14, yang impiannya untuk berbual dengan Perdana Menteri Datuk Seri Najib Tun Razak menjadi kenyataan bulan lepas, meninggal dunia pada pukul 11.05 malam semalam.

Menurut pegawai dari pejabat Perdana Menteri, jenazah Nurul Atikah kini berada di rumahnya di No 9, Lorong 4, Taman Mewah Kamunting Taiping dan akan dikebumikan esok.

Pada 19 Ogos lalu, Nurul Atikah berpeluang berbual dengan Perdana Menteri Datuk Seri Najib Tun Razak, yang menjadi impiannya.

Nurul Atikah berpeluang berbual selama lima minit dengan Najib, menggunakan telefon bimbit Menteri Besar Perak Datuk Seri Dr. Zambry Abdul Kadir yang mengunjungi beliau di rumahnya di Taman Mewah, Kamunting, Taiping Perak.

Sumber : Utusan / Bernama
Gambar : Mstar

most search Malaysia (based from Google) for the last 7 days





WEBSITES

Top searches
1. facebook
2. youtube
3. download
4. facebook login
5. google
6. yahoo
7. games
8. mail
9. fb
10. you

Rising searches
1. student portal
2. jawatan kosong
3. uitm
4. mudah.my
5. jobstreet
6. mas
7. ptptn
8. kosmo
9. mail
10. mudah

IMAGES

Top searches
1. malaysia
2. wallpaper
3. girl
4. love
5. cartoon
6. cute
7. raya
8. black
9. melayu
10. bogel

Rising searches
1. 1 malaysia
2. border
3. smurf
4. water
5. abstract
6. flowers
7. backgrounds
8. poster
9. sony ericsson xperia
10. vintage

Gambit Saifullah mengaku kata ANJING / BABI. Well, that's not a news to me.


Baru-baru ini dalam filem Hantu Bonceng, orang kata perkataan 'babi' terlepas dan ini memberikan kesan yang tak baik bagi anak-anak kecil.

Lepas tu Gambit pulak yang masuk paper (Harian Metro hari ini).

Well, guys,... Ahmad Busu dalam Pi Mai Pi Mai Tang Tu lama dahulu rilek je mengutuk orang, tapi versi dia lain sikit. "...dia telah tertelan siput 'KHINZIR'". kan elok bunyinya tu....


kat Malaysia tu boleh nak kutuk, tapi takleh sebut BABI, tapi sebutlah KHINZIR.

well, somebody please explain this to me. i tak faham.

Gambar : http://mygambitsaifullah.blogspot.com/

Friday, September 9, 2011

"i laughed so hard im gonna cry now. it's ok to be heartbroken, at least cukup makan kan? "



oh , look baby. the used.

I know but tau 1 2 lagu je -_- I'm lame liddat

i know few songs, but my only fav is this one off Resident Evil soundtrack which they never play live

so ada bagusnya simpan RM88 untuk makan, sekian

i laughed so hard im gonna cry now. it's ok to be heartbroken, at least cukup makan kan? :")

you laugh because of?

i laughed at the sad truth, which is me at the moment

you laughed at yourself or at me? Speak truth now!

seriously, at myself. this is depressing and i have only me. so like you said, let's eat.

let's :D hahahahaha tp u masuk free, untunglah






so, ada baiknya kamu fikir pasal mencari seperiuk nasik daripada menyakitkan hati memikirkan sesuatu yang tak pasti (ah, again...) atas dasar prinsip archimedes starving artist yang deritanya tak berpenghujung. kamu bahagia dengan yg tersayang macamana sekalipun tak berguna kalau dapur tak berasap, dengan kata lain cinta kamu tak dapat menjadikan jongkong emas bijih timah jatuh dari langit secara automatik.

bodoh. your rescue squad is too exhausted.

“when does heart can be rational?”


#and most of the times i just keep it quiet and let it burn and buried deep inside of me #i am just plain weird just like that #i supposed to have a mirror but i broke it #jangan menjangkitkan kesakitan pada orang lain ibarat salival tranfusion #sometimes i can't understand myself #tapi saya hanya sebutir zarah dan suara saya amat kecil untuk didengar satu cakerawala #thanks a lot #this is for you actually #true i am a bit difficult #you never heard this because im living with a ghost and you're living but dead living but deadly to me #this is like narcissistic drama king gone math metal and awry

and you know what, the saviour you've been waiting for is not there for you, because she's not there or better, never exist.

angel dies or there is no angel here, whichever is better.


or it's just maybe i am breaking your heart, killing you softly, unintentionally, so that i don't pay attention.

*throwing a confetti over a mediocre-heartbreaking post in just plain wrong
** you yourself wanna be happy, so be it. yes, you. the third.
***you're still stuck, chained and wired and surrounded by a school of fishes and sea monkey of opportunist #fact

Thursday, September 8, 2011

Apa cerita Malaysian Boy sebenarnya dan benarkah Altimet disaman Kanye West kerana menciplak lagu?



Sebenarnya, sungguh tak hipster kalau tak bercakap tentang video muzik Malaysian Boy yang dijana oleh hype Twitter melalui trending 'Malaysian Boy' dan #KanyeWestSamanAltimet apabila semua blog hiboran bercerita tentangnya.

Tapi saya ada bagitau Altimet, hype Twitter ini kalau kena gayanya, ia dapat memberi trafik ala-ala 'Mpop Mak Kau Syaitan' M24:7, tetapi lebih positif vibenya.

Bagi yang bongok tentang hip hop dan segala bagai muzik, pasti akan terjun kepada konklusi yang lagu Malaysian Boy merupakan celupan haram dari lagu American Boy sedang ianya merupakan versi cover dalam bahasa Melayu ala Poe dengan Alalalalatok tahun 1994 dulu yang menyadur lagu Sweat. Saya lihat ramai yang terjun ke arah konklusi tersebut ibarat terjun KB Mall.

Hype lagu ini makin jadi genius ala David Bowie dengan fiksyen Ziggy Stardust apabila ramai menyebut mereka ternampak hantu dalam video ini yang berdampingan di sebelah DJ Fuzz pada saat ke 42.

Yang lebih menarik pada saya, ada bunga dalam video muzik ini. Empunya badan ialah Ila Damiaa yang merupakan bekas peserta program realiti televisyen Mentor.

video muzik ini sebenarnya ialah promosi untuk Konsert Suara Kami yang bakal berlangsung 17 September ini di Stadium Merdeka. Sekali tengok video muzik ni, memula ingat promo merdeka...


[MTV] Altimet, DJ Fuzz, Ila Damiaa, Point Blanc, Rabbit Mac - Malaysian Boy

For Maxis Subscribers Only:
Caller Ringtone (Chorus)
Dail *131*232588# & send

Caller Ringtone (Verses)
Dail *131*232589# & send

For All Telcos:
True tone Chorus
GET 6916676 & send to 32323

True tone Verses
GET 6916677 & send to 32323

For All Telcos:
Full song download
GET 6916675 & send to 32323

*kredit video muzik untuk Astro Music

You don't wanna go to shopping mall with Gary Numan



bak kata Brodie dalam filem Mallrats: "Listen, not a year goes by, not a year, that I don't hear about some escalator accident involving some bastard kid which could have easily been avoided had some parent - I don't care which one - but some parent conditioned him to fear and respect that escalator."

Battles telah melancarkan video muzik "My Machines" arahan Daniels untuk The Creators Project. Video muzik unik dengan satu pandangan ala-ala video muzik OK Go ini kita boleh lihat di sebalik tabirnya beberapa ketika nanti tetapi untuk seketika ini anda boleh layan video muzik ini dahulu.



Kredit produksi:
Music video for “My Machines” by Battles feat. Gary Numan
Directed by Daniels
Co-produced by The Creators Project and Warp Records
Photo Courtesy of Atiba

Tuesday, September 6, 2011

#KenapaSingle ? : sebuah monolog Twitter



- #KenapaSingle i'm looking California and feeling Minnesota, goddamit! #ChrisCornell #Badmotorfinger
- #KenapaSingle ? well, nak nama nama lain? Soap bar? Dog ear? Deffo not humbucker.
- #KenapaSingle selagi @tiztiztiz tak activate Twitter dia, no fuckin way
- #KenapaSingle you're so gay, gay, gay. oh gaylord, grounded for life. episode The Ramones reunion.
- #KenapaSingle ialah pasar borong untuk membeli simpati. fucken unbelievable....
- #KenapaSingle because i am so full of himself ibarat David Bowie yang obses dengan Ziggy Stardust
- #KenapaSingle memberi saya ilham untuk menggunakan liner notes Red Sparowes. saya kejam sebegitu tapi masih bagi kucing makan #petknode
- #KenapaSingle ? Yes, saya suka. Awak tahu apa makna "I need a closure"?

... gosh, esok-esok kau buat #hashtag "Mengapa Harus Peah?", ohkay?
"Mengapa Harus Mek Joh".

*gambar sekadar hiasan

WTFBBQ! Tahu siapa gantikan SUM41 & Dashboard Confessional di festival Rockaway?


Inilah mereka.... choba teka.

laporan asal : Twitter Obefiend

#petknode : RM100, 000 denda, 6 bulan penjara untuk kekejaman haiwan di bawah akta baru



PUTRAJAYA: Sesiapa yang ditangkap kerana berlaku kejam kepada haiwan akan menghadapi hukuman denda sehingga RM100, 000 dan penjara tidak lebih daripada enam bulan di bawah Akta Kebajikan Haiwan yang akan dibentangkan di Parlimen tahun depan, Perkhidmatan Haiwan, Datuk Dr Abd Aziz Ketua Pengarah Jamaluddin sebagai berkata Isnin lalu.

Beliau berkata Akta itu meliputi semua haiwan, termasuk ikan dan serangga, sama ada yang dimiliki oleh individu atau perniagaan dan mendefinisikan sebagai kezaliman atas kegagalan untuk memberi mereka makan.

"Kami dalam proses mentakrifkan 'kekejaman' untuk mewujudkan kesedaran supaya rakyat sedar bahawa kezaliman kepada haiwan boleh menjadi tujuan atau tidak disengajakan," katanya kepada pemberita di sini.

Laporan asal - The Star / Bernama

Google Hates Najib?


awhh.... i did'nt know that...

Sunday, September 4, 2011

"Ayam Sweat Sour"




Ayam Sweat Sour = Ayam Peluh Masam?


Daging? Sotong? Ayam? Eh, semuanya dibuat dengan peluh masam yang penuh keikhlasan seperti peluh petani.

originally from Encil Aidil from Couple

Saturday, September 3, 2011

"Tiba-tiba Malaysia meminati Pearl Jam kerana Last Kiss… hehe."




This is sooooooooooooooooooooooooooooooooooooooooooooooooooo true!

Originally from here: http://mamaikmal.blogspot.com/2006/08/rearviewmirror-on-pearl-jam.html

Hari Juliana Evans



no, no.... bukan birthday juliana evans. it's just ... random....


memandangkan hari ini ialah hari Juliana Evans, mari kita lihat gosip terbaru Juliana hari ini!

- Hantu Bonceng macam sampah. Nasib baik Juliana Evans comel dalam cerita tu.
- Juliana Evans Jawab Perihal Zizan Raja Lawak dan ‘Nasi Kangkang” http://t.co/OJoIS8f
- Kucing Satukan Zizan Dan Juliana Evans http://t.co/wXApjtE
- Zizan Raja Lawak akui Cintakan Juliana Evans.: Penzahiran cinta ini dapat dilihat keserasiannya melalui filem Hantu Bonceng. (Tapi Juliana tak cintakan Zizan. jangan tertipu ye...)
- "Juliana Evans sungguh mengeWOWkan aku.. =D" - Areev I-Zat
- "bila tgk muka juliana evans , SUMPAH DEMI ALLAH ! ak nak teman hidup ! pfft ! AWEK SHAWL plizz ! ==" - Haikal Majid
- "Oh, mengapa la saya tak mcm dia? Diana danielle tu. And juliana evans. Tampak hot jeh biarpun chenchubby sikit. Pasrah (⌣́_⌣̀)"- Elly Elinna
- nasik kangkang juliana evans sape xnk bro??!!!!hahaha
- Juliana Evans tak sesuai berlakon jadi bohsia. cakap melayu pun ada sleng juga.
- Hantu Boncheng's dialogue, very the very annoying. The story was good and funny... Juliana Evans, (Y)
- "Kak Juliana Evans buat sy mcm x wujud saja. :'( nk buat mcm mne, manalah tahu kdg2 sy ni annoying, hnya allah saja yg tahu." <---- ini Twitter JulianaEvanFans yang berupa spambot sahaja gayanya.
- Tengok Juliana Evans speaking dalam KAMI macam tengok TV series US... fasih sungguh.
- kalau aku, aku nak Juliana Evans jadi suri rumah aku. eh? boleh kira ke macam tu? hahaha
- Tercabar keimanan menonton babak tunjuk betis Juliana Evans tadi, hehe





3 lagi Juliana yang anda perlu tahu selain Juliana Evans



1. Juliana Hatfield

the original miss 'the heart that hurts id the heart that works.'



2. Juliana Theory

American indie rock band.



3. Juliana Banos

the original miss 'tak kusangka tibak-tibak ku menjadi rebutan 2 duak jejaka!'.



* Juliana Banos photo taken from http://shw.joekeyel.fotopages.com/11939862/Juliana-Banos.html
Related Posts with Thumbnails